Lineage for d2b5ea4 (2b5e A:23-141)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699191Family c.47.1.2: PDI-like [52849] (2 proteins)
    duplication: contains two tandem repeats of this fold
  6. 699204Protein Protein disulfide isomerase, PDI [52850] (5 species)
  7. 699225Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142358] (1 PDB entry)
  8. 699229Domain d2b5ea4: 2b5e A:23-141 [127891]
    complexed with ba, gol

Details for d2b5ea4

PDB Entry: 2b5e (more details), 2.4 Å

PDB Description: Crystal Structure of Yeast Protein Disulfide Isomerase
PDB Compounds: (A:) Protein disulfide-isomerase

SCOP Domain Sequences for d2b5ea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qqeavapedsavvklatdsfneyiqshdlvlaeffapwcghcknmapeyvkaaetlvekn
itlaqidctenqdlcmehnipgfpslkifknsdvnnsidyegprtaeaivqfmikqsqp

SCOP Domain Coordinates for d2b5ea4:

Click to download the PDB-style file with coordinates for d2b5ea4.
(The format of our PDB-style files is described here.)

Timeline for d2b5ea4: