![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
![]() | Family c.47.1.2: PDI-like [52849] (2 proteins) duplication: contains two tandem repeats of this fold |
![]() | Protein Protein disulfide isomerase, PDI [52850] (5 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142358] (1 PDB entry) |
![]() | Domain d2b5ea4: 2b5e A:23-141 [127891] complexed with ba, gol |
PDB Entry: 2b5e (more details), 2.4 Å
SCOP Domain Sequences for d2b5ea4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qqeavapedsavvklatdsfneyiqshdlvlaeffapwcghcknmapeyvkaaetlvekn itlaqidctenqdlcmehnipgfpslkifknsdvnnsidyegprtaeaivqfmikqsqp
Timeline for d2b5ea4: