Lineage for d2b5ea2 (2b5e A:142-239)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168367Family c.47.1.2: PDI-like [52849] (2 proteins)
    duplication: contains two tandem repeats of this fold
  6. 1168380Protein Protein disulfide isomerase, PDI [52850] (5 species)
  7. 1168381Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142358] (1 PDB entry)
    Uniprot P17967 142-239! Uniprot P17967 23-141! Uniprot P17967 240-364! Uniprot P17967 365-504
  8. 1168383Domain d2b5ea2: 2b5e A:142-239 [127889]
    complexed with ba, gol

Details for d2b5ea2

PDB Entry: 2b5e (more details), 2.4 Å

PDB Description: Crystal Structure of Yeast Protein Disulfide Isomerase
PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d2b5ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ea2 c.47.1.2 (A:142-239) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avavvadlpaylanetfvtpvivqsgkidadfnatfysmankhfndydfvsaenadddfk
lsiylpsamdepvvyngkkadiadadvfekwlqvealp

SCOPe Domain Coordinates for d2b5ea2:

Click to download the PDB-style file with coordinates for d2b5ea2.
(The format of our PDB-style files is described here.)

Timeline for d2b5ea2: