Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.2: PDI-like [52849] (3 proteins) duplication: contains two tandem repeats of this fold |
Protein Protein disulfide isomerase, PDI [52850] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142358] (1 PDB entry) Uniprot P17967 142-239! Uniprot P17967 23-141! Uniprot P17967 240-364! Uniprot P17967 365-504 |
Domain d2b5ea1: 2b5e A:365-504 [127888] complexed with ba, gol |
PDB Entry: 2b5e (more details), 2.4 Å
SCOPe Domain Sequences for d2b5ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vksqeifenqdssvfqlvgknhdeivndpkkdvlvlyyapwcghckrlaptyqeladtya natsdvliakldhtendvrgvviegyptivlypggkksesvvyqgsrsldslfdfikeng hfdvdgkalyeeaqekaaee
Timeline for d2b5ea1: