Lineage for d2b5dx2 (2b5d X:1-404)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850677Family c.6.2.4: AmyC N-terminal domain-like [102189] (3 proteins)
    automatically mapped to Pfam PF03065
  6. 2850678Protein Alpha-amylase AmyC [141951] (1 species)
  7. 2850679Species Thermotoga maritima [TaxId:2336] [141952] (1 PDB entry)
    Uniprot A1GKL6 1-404
  8. 2850680Domain d2b5dx2: 2b5d X:1-404 [127887]
    Other proteins in same PDB: d2b5dx1

Details for d2b5dx2

PDB Entry: 2b5d (more details), 2.2 Å

PDB Description: Crystal structure of the novel alpha-amylase AmyC from Thermotoga maritima
PDB Compounds: (X:) alpha-amylase

SCOPe Domain Sequences for d2b5dx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5dx2 c.6.2.4 (X:1-404) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]}
mrgkiliflhahlpyvhhpeydhfleerwlfeaitetyipllmmfdeiedfrltmsitpp
lmemlssrdlqekyerhmeklielankevertkkehplkhkmakfyrehfekilnvfrsy
dgnilegfkkyqetgkleivtcnathaflplyqmypevvnaqitvgvknyekhmkkhprg
iwlaecgyyqgldlylaqnnveyffvdshafwfadeqprygvyrpimtpsgvfafardpe
sseqvwsaavgypgdpryrefyrdigfdremeyikdyidpsgvrintgikyhritsksld
asqkeyydidlameaveehardflhkkesqarrlmdimgvepvivapfdaelfghwwfeg
vfflkrffelvneskdlklvtasevidtleevqiatpadsswga

SCOPe Domain Coordinates for d2b5dx2:

Click to download the PDB-style file with coordinates for d2b5dx2.
(The format of our PDB-style files is described here.)

Timeline for d2b5dx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b5dx1