Lineage for d2b5dx1 (2b5d X:415-528)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636923Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (10 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 636966Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families) (S)
  5. 637004Family a.8.3.3: AmyC C-terminal domain-like [101086] (2 proteins)
  6. 637005Protein Alpha-amylase AmyC [140365] (1 species)
  7. 637006Species Thermotoga maritima [TaxId:2336] [140366] (1 PDB entry)
  8. 637007Domain d2b5dx1: 2b5d X:415-528 [127886]
    Other proteins in same PDB: d2b5dx2

Details for d2b5dx1

PDB Entry: 2b5d (more details), 2.2 Å

PDB Description: Crystal structure of the novel alpha-amylase AmyC from Thermotoga maritima
PDB Compounds: (X:) alpha-amylase

SCOP Domain Sequences for d2b5dx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5dx1 a.8.3.3 (X:415-528) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]}
tndwiyrhlhemiermidlskkyynssdplvervlnqmlrelflaqssdwafimttrtsv
qyaenrtklhikrflnlydqlvsgrideemlryyewtdaifpeinfrvmardvi

SCOP Domain Coordinates for d2b5dx1:

Click to download the PDB-style file with coordinates for d2b5dx1.
(The format of our PDB-style files is described here.)

Timeline for d2b5dx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b5dx2