SCOPe 2.08: Domain d2b5dx1: 2b5d X:415-528

Lineage for d2b5dx1 (2b5d X:415-528)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families)

5. Family a.8.3.3: AmyC C-terminal domain-like [101086] (2 proteins)
   automatically mapped to Pfam PF09210

6. Protein Alpha-amylase AmyC [140365] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [140366] (1 PDB entry)
   Uniprot A1GKL6 415-528

8. Domain d2b5dx1: 2b5d X:415-528 [127886]
   Other proteins in same PDB: d2b5dx2

Details for d2b5dx1

PDB Entry: 2b5d, 2.2 Å

PDB Description: Crystal structure of the novel alpha-amylase AmyC from Thermotoga maritima

PDB Compounds: (X:) alpha-amylase

SCOPe Domain Sequences for d2b5dx1:

Sequence; same for both SEQRES and ATOM records:

>d2b5dx1 a.8.3.3 (X:415-528) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]}
tndwiyrhlhemiermidlskkyynssdplvervlnqmlrelflaqssdwafimttrtsv
qyaenrtklhikrflnlydqlvsgrideemlryyewtdaifpeinfrvmardvi

Timeline for d2b5dx1:

• d2b5dx1 first appeared in SCOP 1.73
  
• d2b5dx1 appears in SCOPe 2.07