![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) ![]() |
![]() | Family a.8.3.3: AmyC C-terminal domain-like [101086] (2 proteins) automatically mapped to Pfam PF09210 |
![]() | Protein Alpha-amylase AmyC [140365] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [140366] (1 PDB entry) Uniprot A1GKL6 415-528 |
![]() | Domain d2b5dx1: 2b5d X:415-528 [127886] Other proteins in same PDB: d2b5dx2 |
PDB Entry: 2b5d (more details), 2.2 Å
SCOPe Domain Sequences for d2b5dx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5dx1 a.8.3.3 (X:415-528) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]} tndwiyrhlhemiermidlskkyynssdplvervlnqmlrelflaqssdwafimttrtsv qyaenrtklhikrflnlydqlvsgrideemlryyewtdaifpeinfrvmardvi
Timeline for d2b5dx1: