| Class b: All beta proteins [48724] (178 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) ![]() |
| Family b.3.2.2: Pre-dockerin domain [141082] (2 proteins) PfamB PB085396 |
| Protein Cellulosomal scaffolding protein A [141083] (1 species) |
| Species Clostridium thermocellum [TaxId:1515] [141084] (1 PDB entry) Uniprot Q06851 1697-1792 |
| Domain d2b59b2: 2b59 B:8-103 [127881] Other proteins in same PDB: d2b59a1, d2b59b1 complexed with ca |
PDB Entry: 2b59 (more details), 2.11 Å
SCOPe Domain Sequences for d2b59b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b59b2 b.3.2.2 (B:8-103) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]}
gykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpanasgytlk
isratyldrvianvvvtgdtsvstsqapimmwvgdi
Timeline for d2b59b2: