SCOPe 2.06: Domain d2b59b1: 2b59 B:104-163

Lineage for d2b59b1 (2b59 B:104-163)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.1: Type I dockerin domain [63447] (4 proteins)

6. Protein Cellulosomal scaffolding protein A [140135] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [140136] (1 PDB entry)
   Uniprot Q06851 1793-1852

8. Domain d2b59b1: 2b59 B:104-163 [127880]
   Other proteins in same PDB: d2b59a1, d2b59b2
   complexed with ca

Details for d2b59b1

PDB Entry: 2b59, 2.11 Å

PDB Description: the type ii cohesin dockerin complex

PDB Compounds: (B:) cellulosomal scaffolding protein a

SCOPe Domain Sequences for d2b59b1:

Sequence; same for both SEQRES and ATOM records:

>d2b59b1 a.139.1.1 (B:104-163) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]}
vkdnsinlldvaevircfnatkgsanyveeldinrngainmqdimivhkhfgatssdyda

Timeline for d2b59b1:

• d2b59b1 first appeared in SCOP 1.73
  
• d2b59b1 appears in SCOPe 2.05
  
• d2b59b1 appears in SCOPe 2.07
  
• d2b59b1 appears in the current release, SCOPe 2.08