![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
![]() | Superfamily a.139.1: Type I dockerin domain [63446] (1 family) ![]() |
![]() | Family a.139.1.1: Type I dockerin domain [63447] (3 proteins) |
![]() | Protein Cellulosomal scaffolding protein A [140135] (1 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [140136] (1 PDB entry) |
![]() | Domain d2b59b1: 2b59 B:104-163 [127880] Other proteins in same PDB: d2b59a1, d2b59b2 complexed with ca |
PDB Entry: 2b59 (more details), 2.11 Å
SCOP Domain Sequences for d2b59b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b59b1 a.139.1.1 (B:104-163) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]} vkdnsinlldvaevircfnatkgsanyveeldinrngainmqdimivhkhfgatssdyda
Timeline for d2b59b1: