Lineage for d2b59b1 (2b59 B:104-163)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
    tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand
  4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families) (S)
  5. Family a.139.1.1: Type I dockerin domain [63447] (4 proteins)
  6. Protein Cellulosomal scaffolding protein A [140135] (1 species)
  7. Species Clostridium thermocellum [TaxId:1515] [140136] (1 PDB entry)
    Uniprot Q06851 1793-1852
  8. Domain d2b59b1: 2b59 B:104-163 [127880]
    Other proteins in same PDB: d2b59a1, d2b59b2
    complexed with ca

Details for d2b59b1

PDB Entry: 2b59 (more details), 2.11 Å

PDB Description: the type ii cohesin dockerin complex
PDB Compounds: (B:) cellulosomal scaffolding protein a

SCOPe Domain Sequences for d2b59b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b59b1 a.139.1.1 (B:104-163) Cellulosomal scaffolding protein A {Clostridium thermocellum [TaxId: 1515]}
vkdnsinlldvaevircfnatkgsanyveeldinrngainmqdimivhkhfgatssdyda

SCOPe Domain Coordinates for d2b59b1 are not available.

Timeline for d2b59b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b59b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2b59a1