SCOPe 2.06: Domain d2b59a1: 2b59 A:17-182

Lineage for d2b59a1 (2b59 A:17-182)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [141079] (4 PDB entries)
   Uniprot P71143 30-191! Uniprot P71143 30-195

8. Domain d2b59a1: 2b59 A:17-182 [127879]
   Other proteins in same PDB: d2b59b1, d2b59b2
   complexed with ca

Details for d2b59a1

PDB Entry: 2b59, 2.11 Å

PDB Description: the type ii cohesin dockerin complex

PDB Compounds: (A:) COG1196: Chromosome segregation ATPases

SCOPe Domain Sequences for d2b59a1:

Sequence; same for both SEQRES and ATOM records:

>d2b59a1 b.2.2.2 (A:17-182) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss
tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki
lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl

Timeline for d2b59a1:

• d2b59a1 first appeared in SCOP 1.73
  
• d2b59a1 appears in SCOPe 2.05
  
• d2b59a1 appears in SCOPe 2.07
  
• d2b59a1 appears in the current release, SCOPe 2.08