![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (6 proteins) Pfam PF00963 |
![]() | Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [141079] (2 PDB entries) |
![]() | Domain d2b59a1: 2b59 A:17-182 [127879] Other proteins in same PDB: d2b59b1, d2b59b2 complexed with ca |
PDB Entry: 2b59 (more details), 2.11 Å
SCOP Domain Sequences for d2b59a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b59a1 b.2.2.2 (A:17-182) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]} kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl
Timeline for d2b59a1: