Lineage for d2b59a1 (2b59 A:17-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767240Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
    Pfam PF00963
  6. 2767311Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species)
  7. 2767312Species Clostridium thermocellum [TaxId:1515] [141079] (4 PDB entries)
    Uniprot P71143 30-191! Uniprot P71143 30-195
  8. 2767314Domain d2b59a1: 2b59 A:17-182 [127879]
    Other proteins in same PDB: d2b59b1, d2b59b2
    complexed with ca

Details for d2b59a1

PDB Entry: 2b59 (more details), 2.11 Å

PDB Description: the type ii cohesin dockerin complex
PDB Compounds: (A:) COG1196: Chromosome segregation ATPases

SCOPe Domain Sequences for d2b59a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b59a1 b.2.2.2 (A:17-182) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]}
kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss
tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki
lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl

SCOPe Domain Coordinates for d2b59a1:

Click to download the PDB-style file with coordinates for d2b59a1.
(The format of our PDB-style files is described here.)

Timeline for d2b59a1: