Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
Protein Scaffolding dockerin binding protein A, SdbA [141078] (1 species) |
Species Clostridium thermocellum [TaxId:1515] [141079] (4 PDB entries) Uniprot P71143 30-191! Uniprot P71143 30-195 |
Domain d2b59a1: 2b59 A:17-182 [127879] Other proteins in same PDB: d2b59b1, d2b59b2 complexed with ca |
PDB Entry: 2b59 (more details), 2.11 Å
SCOPe Domain Sequences for d2b59a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b59a1 b.2.2.2 (A:17-182) Scaffolding dockerin binding protein A, SdbA {Clostridium thermocellum [TaxId: 1515]} kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl
Timeline for d2b59a1: