SCOP 1.73: Domain d2b58a1: 2b58 A:4-170

Lineage for d2b58a1 (2b58 A:4-170)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)

6. Protein Diamine acetyltransferase 1 [143652] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143653] (10 PDB entries)

8. Domain d2b58a1: 2b58 A:4-170 [127878]
   automatically matched to 2B3U A:2-170
   complexed with coa; mutant

Details for d2b58a1

PDB Entry: 2b58, 1.95 Å

PDB Description: ssat with coa_sp, spermine disordered, k26r mutant

PDB Compounds: (A:) Diamine acetyltransferase 1

SCOP Domain Sequences for d2b58a1:

Sequence; same for both SEQRES and ATOM records:

>d2b58a1 d.108.1.1 (A:4-170) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
fvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevpkeh
wtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcs
smhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate

Timeline for d2b58a1:

• d2b58a1 is new in SCOP 1.73
  
• d2b58a1 appears in SCOP 1.75
  
• d2b58a1 appears in the current release, SCOPe 2.08, called d2b58a_