Lineage for d2b50a_ (2b50 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923773Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 923774Species Human (Homo sapiens) [TaxId:9606] [48527] (12 PDB entries)
  8. 923775Domain d2b50a_: 2b50 A: [127872]
    automated match to d1gwxa_
    complexed with b7g, ca, vca

Details for d2b50a_

PDB Entry: 2b50 (more details), 2 Å

PDB Description: Human Nuclear Receptor-Ligand Complex 2
PDB Compounds: (A:) Peroxisome proliferator activated receptor delta

SCOPe Domain Sequences for d2b50a_:

Sequence, based on SEQRES records: (download)

>d2b50a_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
qmmqrikktetetslhpllqeiykdm

Sequence, based on observed residues (ATOM records): (download)

>d2b50a_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwklppyk
eisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivn
kdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcg
drpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqr
ikktetetslhpllqeiykdm

SCOPe Domain Coordinates for d2b50a_:

Click to download the PDB-style file with coordinates for d2b50a_.
(The format of our PDB-style files is described here.)

Timeline for d2b50a_: