Lineage for d2b4ya1 (2b4y A:36-302)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828384Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 828385Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 828587Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (7 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 828635Protein NAD-dependent deacetylase sirtuin-5 [142128] (1 species)
  7. 828636Species Human (Homo sapiens) [TaxId:9606] [142129] (2 PDB entries)
    Uniprot Q9NXA8 36-302
  8. 828637Domain d2b4ya1: 2b4y A:36-302 [127868]
    complexed with apr, epe, zn

Details for d2b4ya1

PDB Entry: 2b4y (more details), 1.9 Å

PDB Description: Crystal Structure of Human Sirtuin homolog 5
PDB Compounds: (A:) NAD-dependent deacetylase sirtuin-5

SCOP Domain Sequences for d2b4ya1:

Sequence, based on SEQRES records: (download)

>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]}
psssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplafahnp
srvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknll
eihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggl
lrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefn
tettpatnrfrfhfqgpcgttlpeala

Sequence, based on observed residues (ATOM records): (download)

>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]}
psssmadfrkffakakhiviisgagvsaesgvgywrkwqaqdlatplafahnpsrvwefy
hyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknlleihgslf
ktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggllrphvvw
fgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefntettpat
nrfrfhfqgpcgttlpeala

SCOP Domain Coordinates for d2b4ya1:

Click to download the PDB-style file with coordinates for d2b4ya1.
(The format of our PDB-style files is described here.)

Timeline for d2b4ya1: