Lineage for d2b4wa1 (2b4w A:2-311)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674809Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 674815Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families) (S)
  5. 674902Family b.67.2.5: LmjF10.1260-like [141543] (1 protein)
  6. 674903Protein Hypothetical protein LmjF10.1260 [141544] (1 species)
  7. 674904Species Leishmania major [TaxId:5664] [141545] (1 PDB entry)
  8. 674905Domain d2b4wa1: 2b4w A:2-311 [127866]

Details for d2b4wa1

PDB Entry: 2b4w (more details), 1.98 Å

PDB Description: hypothetical protein from leishmania major
PDB Compounds: (A:) hypothetical protein, conserved

SCOP Domain Sequences for d2b4wa1:

Sequence, based on SEQRES records: (download)

>d2b4wa1 b.67.2.5 (A:2-311) Hypothetical protein LmjF10.1260 {Leishmania major [TaxId: 5664]}
kqvkaafeankrvyesvlltfkgvdgydvyncsvpfsykgkthiygrvekrdiwaashvr
lfeetgkdeftavpelsweledpyiakinnemifggtrvrkngnailsyygyfyrgtpde
ltyftrgpgcmkdirvlqlqdgrlgvfsrprvgrkasigfvilnsidelgaeviakappl
dilsenawggvnqayllssgkvgcighysyedtnekqqpqsvyvnyafvldpqsraitga
kiigtkscyppcepkvplladcvfasgivmrsdgkvdlysgvgdshegritidypfkghg
tiigdlhfpm

Sequence, based on observed residues (ATOM records): (download)

>d2b4wa1 b.67.2.5 (A:2-311) Hypothetical protein LmjF10.1260 {Leishmania major [TaxId: 5664]}
kqvkaafeankrvyesvlltfkgvdgydvyncsvpfsykgkthiygrvekrdiwaashvr
lfeetgkdeftavpelsweledpyiakinnemifggtrvrilsyygyfyrgtpdeltyft
rgpgcmkdirvlqlqdgrlgvfsrprvasigfvilnsidelgaeviakappldilnawgg
vnqayllssgkvgcighysyeqsvyvnyafvldpqsraitgakiigtkscyppcepkvpl
ladcvfasgivmrsdgkvdlysgvgdshegritidypfkghgtiigdlhfpm

SCOP Domain Coordinates for d2b4wa1:

Click to download the PDB-style file with coordinates for d2b4wa1.
(The format of our PDB-style files is described here.)

Timeline for d2b4wa1: