Lineage for d2b4va2 (2b4v A:30-288)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740075Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 740076Superfamily d.218.1: Nucleotidyltransferase [81301] (11 families) (S)
  5. 740330Family d.218.1.10: RNA editing terminal uridyl transferase 2, RET2, catalytic domain [143236] (1 protein)
    contains insert domain of a ferredoxin-like fold
  6. 740331Protein RNA editing terminal uridyl transferase 2, TUTase 2, RET2 [143237] (1 species)
  7. 740332Species Trypanosoma brucei [TaxId:5691] [143238] (1 PDB entry)
  8. 740333Domain d2b4va2: 2b4v A:30-288 [127865]
    Other proteins in same PDB: d2b4va1
    complexed with k; mutant

Details for d2b4va2

PDB Entry: 2b4v (more details), 1.8 Å

PDB Description: structural basis for utp specificity of rna editing tutases from trypanosoma brucei
PDB Compounds: (A:) RNA editing complex protein MP57

SCOP Domain Sequences for d2b4va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4va2 d.218.1.10 (A:30-288) RNA editing terminal uridyl transferase 2, TUTase 2, RET2 {Trypanosoma brucei [TaxId: 5691]}
npspdhyavwgkaimaennrrvgpehmfrtairaqqqlqgladkwtpdakvyccgsmvty
gqmergsdldlacmfddpypshevqakrtdklrtvikryvphylrnnllglteartpvvk
lrfandekvararytplseeedrkartalldvrnqcvgdndveyiaekmgrdnvegirvd
rttygcriaiqctskeqmieaigffpdgkimtrgmredytrdvldvrfvpemfmyrwdis
fvgygvknsylirhylhng

SCOP Domain Coordinates for d2b4va2:

Click to download the PDB-style file with coordinates for d2b4va2.
(The format of our PDB-style files is described here.)

Timeline for d2b4va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b4va1