Lineage for d2b4va1 (2b4v A:289-471)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650456Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 650457Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (4 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 650502Family a.160.1.4: RNA editing terminal uridyl transferase 2, RET2, domain 2 [140679] (1 protein)
  6. 650503Protein RNA editing terminal uridyl transferase 2, TUTase 2, RET2 [140680] (1 species)
  7. 650504Species Trypanosoma brucei [TaxId:5691] [140681] (1 PDB entry)
  8. 650505Domain d2b4va1: 2b4v A:289-471 [127864]
    Other proteins in same PDB: d2b4va2
    complexed with k; mutant

Details for d2b4va1

PDB Entry: 2b4v (more details), 1.8 Å

PDB Description: structural basis for utp specificity of rna editing tutases from trypanosoma brucei
PDB Compounds: (A:) RNA editing complex protein MP57

SCOP Domain Sequences for d2b4va1:

Sequence, based on SEQRES records: (download)

>d2b4va1 a.160.1.4 (A:289-471) RNA editing terminal uridyl transferase 2, TUTase 2, RET2 {Trypanosoma brucei [TaxId: 5691]}
pvaarhtamavkawgkatnvgagsgamltsyavtvmfiyyllvtrqvlwvdpwslphpah
lprypdfsplydcdptelgrllhgffifyahhfdyerevvslnrnrrsyrsdigwnfpqn
kkgtfsynfciedpyedvgtgglnlvrhlhpakfqlvkqeflraaqcmerflptnapeks
ilg

Sequence, based on observed residues (ATOM records): (download)

>d2b4va1 a.160.1.4 (A:289-471) RNA editing terminal uridyl transferase 2, TUTase 2, RET2 {Trypanosoma brucei [TaxId: 5691]}
pvaarhtamavkawgkatngamltsyavtvmfiyyllvtrqvlwvdpwslphpahlpryp
dfsplydcdptelgrllhgffifyahhfdyerevvslnrnrrsyrsdigwnfpqnkkgtf
synfciedpyedvgtgglnlvrhlhpakfqlvkqeflraaqcmerflptnapeksilg

SCOP Domain Coordinates for d2b4va1:

Click to download the PDB-style file with coordinates for d2b4va1.
(The format of our PDB-style files is described here.)

Timeline for d2b4va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b4va2