![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143536] (3 PDB entries) |
![]() | Domain d2b4tr2: 2b4t R:153-318 [127863] Other proteins in same PDB: d2b4to1, d2b4tp1, d2b4tq1, d2b4tr1 automatically matched to 2B4R O:153-318 complexed with aes, nad; mutant |
PDB Entry: 2b4t (more details), 2.5 Å
SCOP Domain Sequences for d2b4tr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4tr2 d.81.1.1 (R:153-318) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} cttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdwragrcalsniipa stgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegp lkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswyd
Timeline for d2b4tr2: