SCOPe 2.07: Domain d2b4tp1: 2b4t P:4-152,P:319-335

Lineage for d2b4tp1 (2b4t P:4-152,P:319-335)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (4 PDB entries)
Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337
Domain d2b4tp1: 2b4t P:4-152,P:319-335 [127858]
Other proteins in same PDB: d2b4to2, d2b4to3, d2b4tp2, d2b4tp3, d2b4tq2, d2b4tq3, d2b4tr2, d2b4tr3
automated match to d2b4ro1
complexed with aes, nad

Details for d2b4tp1

PDB Entry: 2b4t (more details), 2.5 Å

PDB Description: crystal structure of glyceraldehyde-3-phosphate dehydrogenase from plasmodium falciparum at 2.25 angstrom resolution reveals intriguing extra electron density in the active site

PDB Compounds: (P:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2b4tp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4tp1 c.2.1.3 (P:4-152,P:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
tklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevtha
dgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvimsa
ppkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhit

SCOPe Domain Coordinates for d2b4tp1:

Click to download the PDB-style file with coordinates for d2b4tp1.
(The format of our PDB-style files is described here.)

Timeline for d2b4tp1: