![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species) |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (3 PDB entries) |
![]() | Domain d2b4tp1: 2b4t P:4-152,P:319-335 [127858] Other proteins in same PDB: d2b4to2, d2b4tp2, d2b4tq2, d2b4tr2 automatically matched to 2B4R O:4-152,O:319-335 complexed with aes, nad; mutant |
PDB Entry: 2b4t (more details), 2.5 Å
SCOP Domain Sequences for d2b4tp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4tp1 c.2.1.3 (P:4-152,P:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} tklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevtha dgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvimsa ppkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhit
Timeline for d2b4tp1: