SCOP 1.73: Domain d2b4to2: 2b4t O:153-318

Lineage for d2b4to2 (2b4t O:153-318)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143536] (3 PDB entries)

8. Domain d2b4to2: 2b4t O:153-318 [127857]
   Other proteins in same PDB: d2b4to1, d2b4tp1, d2b4tq1, d2b4tr1
   automatically matched to 2B4R O:153-318
   complexed with aes, nad; mutant

Details for d2b4to2

PDB Entry: 2b4t, 2.5 Å

PDB Description: crystal structure of glyceraldehyde-3-phosphate dehydrogenase from plasmodium falciparum at 2.25 angstrom resolution reveals intriguing extra electron density in the active site

PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d2b4to2:

Sequence; same for both SEQRES and ATOM records:

>d2b4to2 d.81.1.1 (O:153-318) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdwragrcalsniipa
stgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegp
lkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswyd

Timeline for d2b4to2:

• d2b4to2 is new in SCOP 1.73
  
• d2b4to2 appears in SCOP 1.75
  
• d2b4to2 appears in the current release, SCOPe 2.08