SCOPe 2.03: Domain d2b4to1: 2b4t O:4-152,O:319-336

Lineage for d2b4to1 (2b4t O:4-152,O:319-336)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (3 PDB entries)
   Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337

8. Domain d2b4to1: 2b4t O:4-152,O:319-336 [127856]
   Other proteins in same PDB: d2b4to2, d2b4tp2, d2b4tq2, d2b4tr2
   automated match to d2b4ro1
   complexed with aes, nad

Details for d2b4to1

PDB Entry: 2b4t, 2.5 Å

PDB Description: crystal structure of glyceraldehyde-3-phosphate dehydrogenase from plasmodium falciparum at 2.25 angstrom resolution reveals intriguing extra electron density in the active site

PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2b4to1:

Sequence; same for both SEQRES and ATOM records:

>d2b4to1 c.2.1.3 (O:4-152,O:319-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
tklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevtha
dgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvimsa
ppkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhitt

Timeline for d2b4to1:

• d2b4to1 first appeared in SCOP 1.73
  
• d2b4to1 appears in SCOPe 2.02
  
• d2b4to1 appears in SCOPe 2.04
  
• d2b4to1 appears in the current release, SCOPe 2.08