![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Insulin receptor [56162] (1 species) PTK group; InsR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries) |
![]() | Domain d2b4sd_: 2b4s D: [127855] Other proteins in same PDB: d2b4sa_, d2b4sc_ automated match to d1p14a_ complexed with so4 |
PDB Entry: 2b4s (more details), 2.3 Å
SCOPe Domain Sequences for d2b4sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4sd_ d.144.1.7 (D:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk
Timeline for d2b4sd_: