SCOPe 2.04: Domain d2b4sd_: 2b4s D:

Lineage for d2b4sd_ (2b4s D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Insulin receptor [56162] (1 species)
   PTK group; InsR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56163] (16 PDB entries)

8. Domain d2b4sd_: 2b4s D: [127855]
   Other proteins in same PDB: d2b4sa_, d2b4sc_
   automated match to d1p14a_
   complexed with so4

Details for d2b4sd_

PDB Entry: 2b4s, 2.3 Å

PDB Description: crystal structure of a complex between ptp1b and the insulin receptor tyrosine kinase

PDB Compounds: (D:) Insulin receptor

SCOPe Domain Sequences for d2b4sd_:

Sequence; same for both SEQRES and ATOM records:

>d2b4sd_ d.144.1.7 (D:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

Timeline for d2b4sd_:

• d2b4sd_ first appeared in SCOP 1.73, called d2b4sd1
  
• d2b4sd_ appears in SCOPe 2.03
  
• d2b4sd_ appears in SCOPe 2.05
  
• d2b4sd_ appears in the current release, SCOPe 2.08