Lineage for d2b4sb1 (2b4s B:987-1283)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874885Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 874886Species Human (Homo sapiens) [TaxId:9606] [56163] (12 PDB entries)
  8. 874893Domain d2b4sb1: 2b4s B:987-1283 [127854]
    Other proteins in same PDB: d2b4sa1
    automatically matched to d1rqqa_
    complexed with so4

Details for d2b4sb1

PDB Entry: 2b4s (more details), 2.3 Å

PDB Description: Crystal structure of a complex between PTP1B and the insulin receptor tyrosine kinase
PDB Compounds: (B:) Insulin receptor

SCOP Domain Sequences for d2b4sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4sb1 d.144.1.7 (B:987-1283) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

SCOP Domain Coordinates for d2b4sb1:

Click to download the PDB-style file with coordinates for d2b4sb1.
(The format of our PDB-style files is described here.)

Timeline for d2b4sb1: