Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [143536] (3 PDB entries) Uniprot Q8IKK7 153-318! Uniprot Q8T6B1 153-318 |
Domain d2b4rq2: 2b4r Q:153-318 [127850] Other proteins in same PDB: d2b4ro1, d2b4rp1, d2b4rq1, d2b4rr1 automated match to d2b4ro2 complexed with aes, gol, nad |
PDB Entry: 2b4r (more details), 2.25 Å
SCOPe Domain Sequences for d2b4rq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4rq2 d.81.1.1 (Q:153-318) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} cttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdwragrcalsniipa stgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegp lkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswyd
Timeline for d2b4rq2: