Lineage for d2b4rp1 (2b4r P:3-152,P:319-336)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828951Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141916] (3 PDB entries)
    Uniprot Q8IKK7 4-152,319-335! Uniprot Q8T6B1 1-152,319-337
  8. 1828953Domain d2b4rp1: 2b4r P:3-152,P:319-336 [127847]
    Other proteins in same PDB: d2b4ro2, d2b4rp2, d2b4rq2, d2b4rr2
    automated match to d2b4ro1
    complexed with aes, gol, nad

Details for d2b4rp1

PDB Entry: 2b4r (more details), 2.25 Å

PDB Description: crystal structure of glyceraldehyde-3-phosphate dehydrogenase from plasmodium falciparum at 2.25 angstrom resolution reveals intriguing extra electron density in the active site
PDB Compounds: (P:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2b4rp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4rp1 c.2.1.3 (P:3-152,P:319-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
atklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevth
adgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvims
appkddtpiyvmginhhqydtkqlivsnasXnewgysnrvldlavhitt

SCOPe Domain Coordinates for d2b4rp1:

Click to download the PDB-style file with coordinates for d2b4rp1.
(The format of our PDB-style files is described here.)

Timeline for d2b4rp1: