Lineage for d2b4kd2 (2b4k D:50-434)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508774Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins)
  6. 2508775Protein Alpha-amino acid ester hydrolase [89769] (2 species)
  7. 2508776Species Acetobacter pasteurianus [TaxId:438] [102619] (4 PDB entries)
  8. 2508808Domain d2b4kd2: 2b4k D:50-434 [127844]
    Other proteins in same PDB: d2b4ka1, d2b4kb1, d2b4kc1, d2b4kd1
    automatically matched to d1nx9a2
    complexed with gol, pg9

Details for d2b4kd2

PDB Entry: 2b4k (more details), 3.3 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase complexed with phenylglycine
PDB Compounds: (D:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d2b4kd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4kd2 c.69.1.21 (D:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
hdplsvqtgsdipasvhmptdqqrdyikrevmvpmrdgvklytvivipknarnapilltr
tpynakgranrvpnaltmrevlpqgddvfveggyirvfqdirgkygsqgdyvmtrpphgp
lnptktdettdawdtvdwlvhnvpesngrvgmtgssyegftvvmalldphpalkvaapes
pmvdgwmgddwfhygafrqgafdyfvsqmtargggndiprrdaddytnflkagsagsfat
qagldqypfwqrmhahpaydafwqgqaldkilaqrkptvpmlweqglwdqedmwgaihaw
qalkdadvkapntlvmgpwrhsgvnyngstlgplefegdtahqyrrdvfrpffdeylkpg
sasvhlpdaiiyntgdqkwdyyrsw

SCOPe Domain Coordinates for d2b4kd2:

Click to download the PDB-style file with coordinates for d2b4kd2.
(The format of our PDB-style files is described here.)

Timeline for d2b4kd2: