SCOPe 2.05: Domain d2b4kd1: 2b4k D:435-666

Lineage for d2b4kd1 (2b4k D:435-666)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)

6. Protein Alpha-amino acid ester hydrolase [89247] (2 species)

7. Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries)

8. Domain d2b4kd1: 2b4k D:435-666 [127843]
   Other proteins in same PDB: d2b4ka2, d2b4kb2, d2b4kc2, d2b4kd2
   automatically matched to d1nx9a1
   complexed with gol, pg9

Details for d2b4kd1

PDB Entry: 2b4k, 3.3 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase complexed with phenylglycine

PDB Compounds: (D:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d2b4kd1:

Sequence; same for both SEQRES and ATOM records:

>d2b4kd1 b.18.1.13 (D:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk
pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam
tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv
qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk

Timeline for d2b4kd1:

• d2b4kd1 first appeared in SCOP 1.73
  
• d2b4kd1 appears in SCOPe 2.04
  
• d2b4kd1 appears in SCOPe 2.06
  
• d2b4kd1 appears in the current release, SCOPe 2.08