SCOP 1.73: Domain d2b4kb2: 2b4k B:50-434

Lineage for d2b4kb2 (2b4k B:50-434)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.21: PepX catalytic domain-like [69581] (3 proteins)

6. Protein Alpha-amino acid ester hydrolase [89769] (2 species)

7. Species Acetobacter pasteurianus [TaxId:438] [102619] (4 PDB entries)

8. Domain d2b4kb2: 2b4k B:50-434 [127840]
   Other proteins in same PDB: d2b4ka1, d2b4kb1, d2b4kc1, d2b4kd1
   automatically matched to d1nx9a2
   complexed with gol, pg9

Details for d2b4kb2

PDB Entry: 2b4k, 3.3 Å

PDB Description: acetobacter turbidans alpha-amino acid ester hydrolase complexed with phenylglycine

PDB Compounds: (B:) alpha-amino acid ester hydrolase

SCOP Domain Sequences for d2b4kb2:

Sequence; same for both SEQRES and ATOM records:

>d2b4kb2 c.69.1.21 (B:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
hdplsvqtgsdipasvhmptdqqrdyikrevmvpmrdgvklytvivipknarnapilltr
tpynakgranrvpnaltmrevlpqgddvfveggyirvfqdirgkygsqgdyvmtrpphgp
lnptktdettdawdtvdwlvhnvpesngrvgmtgssyegftvvmalldphpalkvaapes
pmvdgwmgddwfhygafrqgafdyfvsqmtargggndiprrdaddytnflkagsagsfat
qagldqypfwqrmhahpaydafwqgqaldkilaqrkptvpmlweqglwdqedmwgaihaw
qalkdadvkapntlvmgpwrhsgvnyngstlgplefegdtahqyrrdvfrpffdeylkpg
sasvhlpdaiiyntgdqkwdyyrsw

Timeline for d2b4kb2:

• d2b4kb2 is new in SCOP 1.73
  
• d2b4kb2 appears in SCOP 1.75
  
• d2b4kb2 appears in the current release, SCOPe 2.08