| Class b: All beta proteins [48724] (165 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) ![]() |
| Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins) |
| Protein Alpha-amino acid ester hydrolase [89247] (2 species) |
| Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries) |
| Domain d2b4kb1: 2b4k B:435-666 [127839] Other proteins in same PDB: d2b4ka2, d2b4kb2, d2b4kc2, d2b4kd2 automatically matched to d1nx9a1 complexed with gol, pg9 |
PDB Entry: 2b4k (more details), 3.3 Å
SCOP Domain Sequences for d2b4kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4kb1 b.18.1.13 (B:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk
pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam
tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv
qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk
Timeline for d2b4kb1: