Lineage for d2b4jb_ (2b4j B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859358Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1859359Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 1859365Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (44 PDB entries)
  8. 1859387Domain d2b4jb_: 2b4j B: [127834]
    Other proteins in same PDB: d2b4jc1, d2b4jd_
    automated match to d1bi4c_
    complexed with gol, po4

Details for d2b4jb_

PDB Entry: 2b4j (more details), 2.02 Å

PDB Description: structural basis for the recognition between hiv-1 integrase and ledgf/p75
PDB Compounds: (B:) Integrase (IN)

SCOPe Domain Sequences for d2b4jb_:

Sequence, based on SEQRES records: (download)

>d2b4jb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d2b4jb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrsagerivdiiatdi

SCOPe Domain Coordinates for d2b4jb_:

Click to download the PDB-style file with coordinates for d2b4jb_.
(The format of our PDB-style files is described here.)

Timeline for d2b4jb_: