![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
![]() | Protein Retroviral integrase, catalytic domain [53108] (4 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (44 PDB entries) |
![]() | Domain d2b4ja_: 2b4j A: [127833] Other proteins in same PDB: d2b4jc1, d2b4jd_ automated match to d1bi4c_ complexed with gol, po4 |
PDB Entry: 2b4j (more details), 2.02 Å
SCOPe Domain Sequences for d2b4ja_:
Sequence, based on SEQRES records: (download)
>d2b4ja_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta vqmavfihnkkrkggiggysagerivdiiatdi
>d2b4ja_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqefviesmnkelkkiigqvrdqaehlktavqmavfihnk ksagerivdiiatdi
Timeline for d2b4ja_: