Lineage for d2b4ja1 (2b4j A:57-208)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702155Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)
  6. 702156Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 702157Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (18 PDB entries)
  8. 702163Domain d2b4ja1: 2b4j A:57-208 [127833]
    Other proteins in same PDB: d2b4jc1, d2b4jd1
    automatically matched to d1biza_
    complexed with gol, po4; mutant

Details for d2b4ja1

PDB Entry: 2b4j (more details), 2.02 Å

PDB Description: structural basis for the recognition between hiv-1 integrase and ledgf/p75
PDB Compounds: (A:) Integrase (IN)

SCOP Domain Sequences for d2b4ja1:

Sequence, based on SEQRES records: (download)

>d2b4ja1 c.55.3.2 (A:57-208) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d2b4ja1 c.55.3.2 (A:57-208) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqefviesmnkelkkiigqvrdqaehlktavqmavfihnkk
sagerivdiiatdi

SCOP Domain Coordinates for d2b4ja1:

Click to download the PDB-style file with coordinates for d2b4ja1.
(The format of our PDB-style files is described here.)

Timeline for d2b4ja1: