Lineage for d2b4ja_ (2b4j A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886114Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. 2886120Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries)
  8. 2886201Domain d2b4ja_: 2b4j A: [127833]
    Other proteins in same PDB: d2b4jc1, d2b4jc2, d2b4jd2, d2b4jd3
    automated match to d1bi4c_
    complexed with gol, po4

Details for d2b4ja_

PDB Entry: 2b4j (more details), 2.02 Å

PDB Description: structural basis for the recognition between hiv-1 integrase and ledgf/p75
PDB Compounds: (A:) Integrase (IN)

SCOPe Domain Sequences for d2b4ja_:

Sequence, based on SEQRES records: (download)

>d2b4ja_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records): (download)

>d2b4ja_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefviesmnkelkkiigqvrdqaehlktavqmavfihnk
ksagerivdiiatdi

SCOPe Domain Coordinates for d2b4ja_:

Click to download the PDB-style file with coordinates for d2b4ja_.
(The format of our PDB-style files is described here.)

Timeline for d2b4ja_: