Lineage for d2b4gb1 (2b4g B:2-313)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 protein domains)
  6. 681670Protein Dihydroorotate dehydrogenase [51397] (7 species)
  7. 681718Species Trypanosoma brucei [TaxId:5691] [141758] (1 PDB entry)
  8. 681720Domain d2b4gb1: 2b4g B:2-313 [127830]
    automatically matched to 2B4G A:2-313
    complexed with br, fmn, gol, oro

Details for d2b4gb1

PDB Entry: 2b4g (more details), 1.95 Å

PDB Description: dihydroorotate dehydrogenase
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOP Domain Sequences for d2b4gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4gb1 c.1.4.1 (B:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]}
slkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryfg
lplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitkek
gtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaav
lndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrrc
pdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgykt
ldefrgrvktmd

SCOP Domain Coordinates for d2b4gb1:

Click to download the PDB-style file with coordinates for d2b4gb1.
(The format of our PDB-style files is described here.)

Timeline for d2b4gb1: