SCOPe 2.01: Domain d2b4db_: 2b4d B:

Lineage for d2b4db_ (2b4d B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Diamine acetyltransferase 1 [143652] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143653] (8 PDB entries)
   Uniprot P21673 2-170! Uniprot P21673 3-169

8. Domain d2b4db_: 2b4d B: [127827]
   automated match to d2b3ua1
   complexed with coa

Details for d2b4db_

PDB Entry: 2b4d, 2 Å

PDB Description: ssat+coa+sp- sp disordered

PDB Compounds: (B:) Diamine acetyltransferase 1

SCOPe Domain Sequences for d2b4db_:

Sequence; same for both SEQRES and ATOM records:

>d2b4db_ d.108.1.1 (B:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee

Timeline for d2b4db_:

• d2b4db_ first appeared in SCOP 1.73, called d2b4db1
  
• d2b4db_ was called d2b4db1 in SCOP 1.75
  
• d2b4db_ appears in SCOPe 2.02
  
• d2b4db_ appears in the current release, SCOPe 2.08