Lineage for d2b4db_ (2b4d B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533263Protein Diamine acetyltransferase 1 [143652] (1 species)
  7. 2533264Species Human (Homo sapiens) [TaxId:9606] [143653] (8 PDB entries)
    Uniprot P21673 2-170! Uniprot P21673 3-169
  8. 2533269Domain d2b4db_: 2b4d B: [127827]
    automated match to d2b3ua1
    complexed with coa

Details for d2b4db_

PDB Entry: 2b4d (more details), 2 Å

PDB Description: ssat+coa+sp- sp disordered
PDB Compounds: (B:) Diamine acetyltransferase 1

SCOPe Domain Sequences for d2b4db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4db_ d.108.1.1 (B:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee

SCOPe Domain Coordinates for d2b4db_:

Click to download the PDB-style file with coordinates for d2b4db_.
(The format of our PDB-style files is described here.)

Timeline for d2b4db_: