Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Diamine acetyltransferase 1 [143652] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143653] (8 PDB entries) Uniprot P21673 2-170! Uniprot P21673 3-169 |
Domain d2b4da_: 2b4d A: [127826] automated match to d2b3ua1 complexed with coa |
PDB Entry: 2b4d (more details), 2 Å
SCOPe Domain Sequences for d2b4da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4da_ d.108.1.1 (A:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
Timeline for d2b4da_: