![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins) |
![]() | Protein Diamine acetyltransferase 1 [143652] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143653] (10 PDB entries) |
![]() | Domain d2b4da1: 2b4d A:3-169 [127826] automatically matched to 2F5I A:3-169 complexed with coa |
PDB Entry: 2b4d (more details), 2 Å
SCOP Domain Sequences for d2b4da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4da1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmat
Timeline for d2b4da1: