Lineage for d2b4cl2 (2b4c L:108-214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516254Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1516472Domain d2b4cl2: 2b4c L:108-214 [127825]
    Other proteins in same PDB: d2b4cc1, d2b4cc2, d2b4cg1, d2b4ch1, d2b4ch2, d2b4cl1
    automatically matched to d1rhha2
    complexed with nag, ndg, so4, xyl

Details for d2b4cl2

PDB Entry: 2b4c (more details), 3.3 Å

PDB Description: crystal structure of hiv-1 jr-fl gp120 core protein containing the third variable region (v3) complexed with cd4 and the x5 antibody
PDB Compounds: (L:) anti-HIV-1 gp120 immunoglobulin X5 light chain

SCOPe Domain Sequences for d2b4cl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
srdstyslgstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d2b4cl2:

Click to download the PDB-style file with coordinates for d2b4cl2.
(The format of our PDB-style files is described here.)

Timeline for d2b4cl2: