Lineage for d2b4cl1 (2b4c L:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511561Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)
  8. 1511623Domain d2b4cl1: 2b4c L:1-107 [127824]
    Other proteins in same PDB: d2b4cc1, d2b4cc2, d2b4cg1, d2b4ch1, d2b4ch2, d2b4cl2
    automatically matched to d1rhha1
    complexed with nag, ndg, so4, xyl

Details for d2b4cl1

PDB Entry: 2b4c (more details), 3.3 Å

PDB Description: crystal structure of hiv-1 jr-fl gp120 core protein containing the third variable region (v3) complexed with cd4 and the x5 antibody
PDB Compounds: (L:) anti-HIV-1 gp120 immunoglobulin X5 light chain

SCOPe Domain Sequences for d2b4cl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvltqspgtlslsageratlscrasqsvssgslawyqqkpgqaprlliygastratgip
drfsgsgsgtdftltigrlepedlavyycqqygtspytfgqgtkleik

SCOPe Domain Coordinates for d2b4cl1:

Click to download the PDB-style file with coordinates for d2b4cl1.
(The format of our PDB-style files is described here.)

Timeline for d2b4cl1: