Lineage for d2b4bb1 (2b4b B:2-170)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) (S)
  5. 870003Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)
  6. 870054Protein Diamine acetyltransferase 1 [143652] (1 species)
  7. 870055Species Human (Homo sapiens) [TaxId:9606] [143653] (10 PDB entries)
    Uniprot P21673 2-170! Uniprot P21673 3-169
  8. 870067Domain d2b4bb1: 2b4b B:2-170 [127819]
    automatically matched to 2B3U A:2-170
    complexed with b33, coa; mutant

Details for d2b4bb1

PDB Entry: 2b4b (more details), 2 Å

PDB Description: ssat+coa+be-3-3-3, k6r mutant
PDB Compounds: (B:) Diamine acetyltransferase 1

SCOP Domain Sequences for d2b4bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4bb1 d.108.1.1 (B:2-170) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
akfvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevpk
ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate

SCOP Domain Coordinates for d2b4bb1:

Click to download the PDB-style file with coordinates for d2b4bb1.
(The format of our PDB-style files is described here.)

Timeline for d2b4bb1: