![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins) |
![]() | Protein Diamine acetyltransferase 1 [143652] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143653] (10 PDB entries) |
![]() | Domain d2b4bb1: 2b4b B:2-170 [127819] automatically matched to 2B3U A:2-170 complexed with b33, coa; mutant |
PDB Entry: 2b4b (more details), 2 Å
SCOP Domain Sequences for d2b4bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b4bb1 d.108.1.1 (B:2-170) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} akfvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevpk ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate
Timeline for d2b4bb1: