Lineage for d2b4ba_ (2b4b A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein Diamine acetyltransferase 1 [143652] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [143653] (8 PDB entries)
    Uniprot P21673 2-170! Uniprot P21673 3-169
  8. Domain d2b4ba_: 2b4b A: [127818]
    automated match to d2b3ua1
    complexed with b33, coa; mutant

Details for d2b4ba_

PDB Entry: 2b4b (more details), 2 Å

PDB Description: ssat+coa+be-3-3-3, k6r mutant
PDB Compounds: (A:) Diamine acetyltransferase 1

SCOPe Domain Sequences for d2b4ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4ba_ d.108.1.1 (A:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}
fvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevpkeh
wtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcs
smhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee

SCOPe Domain Coordinates for d2b4ba_ are not available.

Timeline for d2b4ba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b4bb_