Lineage for d2b4aa1 (2b4a A:2-119)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855559Protein Hypothetical protein BH3024 [142029] (1 species)
  7. 2855560Species Bacillus halodurans [TaxId:86665] [142030] (1 PDB entry)
    Uniprot Q9K8I2 2-119
  8. 2855561Domain d2b4aa1: 2b4a A:2-119 [127817]
    complexed with edo

Details for d2b4aa1

PDB Entry: 2b4a (more details), 2.42 Å

PDB Description: Crystal structure of a response regulator receiver domain protein (bh3024) from bacillus halodurans c-125 at 2.42 A resolution
PDB Compounds: (A:) bh3024

SCOPe Domain Sequences for d2b4aa1:

Sequence, based on SEQRES records: (download)

>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]}
qpfrvtlvedepshatliqyhlnqlgaevtvhpsgsaffqhrsqlstcdllivsdqlvdl
sifslldivkeqtkqpsvlilttgrheliessehnlsylqkpfaiselraaidyhkps

Sequence, based on observed residues (ATOM records): (download)

>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]}
qpfrvtlvedepshatliqyhlnqlgaevtvhpsgsaffqhrsqlstcdllivsdqlvdl
sifslldivkeqtkqpsvlilttgrliessehnlsylqkpfaiselraaidyhkps

SCOPe Domain Coordinates for d2b4aa1:

Click to download the PDB-style file with coordinates for d2b4aa1.
(The format of our PDB-style files is described here.)

Timeline for d2b4aa1: