Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins) Pfam PF00452 |
Protein Apoptosis regulator Bcl-xL [56856] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56857] (14 PDB entries) |
Domain d2b48a1: 2b48 A:1-196 [127816] automatically matched to d1maz__ |
PDB Entry: 2b48 (more details), 3.45 Å
SCOP Domain Sequences for d2b48a1:
Sequence, based on SEQRES records: (download)
>d2b48a1 f.1.4.1 (A:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep wiqenggwdtfvelyg
>d2b48a1 f.1.4.1 (A:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} msqsnrelvvdflsyklsqkgyswpmaavkqalreagdefelryrrafsdltsqlhitpg tayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndh lepwiqenggwdtfvelyg
Timeline for d2b48a1: