Lineage for d2b48a1 (2b48 A:1-196)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 744528Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 744568Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 744569Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
    Pfam PF00452
  6. 744575Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 744576Species Human (Homo sapiens) [TaxId:9606] [56857] (14 PDB entries)
  8. 744583Domain d2b48a1: 2b48 A:1-196 [127816]
    automatically matched to d1maz__

Details for d2b48a1

PDB Entry: 2b48 (more details), 3.45 Å

PDB Description: bcl-xl 3d domain swapped dimer
PDB Compounds: (A:) apoptosis regulator bcl-x

SCOP Domain Sequences for d2b48a1:

Sequence, based on SEQRES records: (download)

>d2b48a1 f.1.4.1 (A:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla
dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep
wiqenggwdtfvelyg

Sequence, based on observed residues (ATOM records): (download)

>d2b48a1 f.1.4.1 (A:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswpmaavkqalreagdefelryrrafsdltsqlhitpg
tayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndh
lepwiqenggwdtfvelyg

SCOP Domain Coordinates for d2b48a1:

Click to download the PDB-style file with coordinates for d2b48a1.
(The format of our PDB-style files is described here.)

Timeline for d2b48a1: