SCOPe 2.08: Domain d2b48a1: 2b48 A:1-196

Lineage for d2b48a1 (2b48 A:1-196)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d2b48a1: 2b48 A:1-196 [127816]
   automatically matched to d1maz__
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d2b48a1

PDB Entry: 2b48, 3.45 Å

PDB Description: bcl-xl 3d domain swapped dimer

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2b48a1:

Sequence, based on SEQRES records:

>d2b48a1 f.1.4.1 (A:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla
dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep
wiqenggwdtfvelyg

Sequence, based on observed residues (ATOM records):

>d2b48a1 f.1.4.1 (A:1-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswpmaavkqalreagdefelryrrafsdltsqlhitpg
tayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndh
lepwiqenggwdtfvelyg

Timeline for d2b48a1:

• d2b48a1 first appeared in SCOP 1.73
  
• d2b48a1 appears in SCOPe 2.07